2EJS
Solution structure of ruh-076, a human cue domain
PDB DOI: 10.2210/pdb2ejs/pdb
Classification: LIGASE Organism(s): Homo Sapiens
Deposited: 2007-03-20 Deposition Author(s): Hayashi, F. , Hirota, H. , Kitasaka, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Ruhul Momen, A.Z.M. , Yokoyama, S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of ruh-076, a human cue domain
Hayashi, F. , Hirota, H. , Kitasaka, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Ruhul Momen, A.Z.M. , Yokoyama, S.
Primary Citation of Related Structures: 2EJS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Autocrine motility factor receptor, isoform 2 | A | 58 | Homo Sapiens | GSSGSSGASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPF |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2007-03-20 Deposition Author(s): Hayashi, F. , Hirota, H. , Kitasaka, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Ruhul Momen, A.Z.M. , Yokoyama, S.