Solution structure of the zf-b_box domain from human tripartite motif protein 41
PDB DOI: 10.2210/pdb2egm/pdb
Classification: TRANSCRIPTION/METAL BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2007-03-01 Deposition Author(s): Hayashi, F. , Inoue, K. , Nagashima, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Solution structure of the zf-b_box domain from human tripartite motif protein 41
Hayashi, F. , Inoue, K. , Nagashima, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Primary Citation of Related Structures: 2EGM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tripartite motif-containing protein 41 | A | 57 | Homo Sapiens | GSSGSSGTPGRGSRVTDQGICPKHQEALKLFCEVDEEAICVVCRESRSHKQHSVVPL |
Method: SOLUTION NMR
Deposited Date: 2007-03-01 Deposition Author(s): Hayashi, F. , Inoue, K. , Nagashima, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.