Neutron crystal structure of cubic insulin at pd6.6
PDB DOI: 10.2210/pdb2efa/pdb
Classification: HORMONE/GROWTH FACTOR Organism(s): Human Metapneumovirus
Deposited: 2007-02-22 Deposition Author(s): Ishikawa, T. , Niimura, N. , Tanaka, I.
Neutron crystal structure of cubic insulin at pd6.6
Ishikawa, T. , Niimura, N. , Tanaka, I.
Primary Citation of Related Structures: 2EFA
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin | A | 21 | Human Metapneumovirus | GIVEQCCTSICSLYQLENYCN |
Insulin | B | 30 | Human Metapneumovirus | FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
Method: NEUTRON DIFFRACTION
Deposited Date: 2007-02-22 Deposition Author(s): Ishikawa, T. , Niimura, N. , Tanaka, I.