Solution structures of the chromo domain of human chromodomain helicase-dna-binding protein 4
PDB DOI: 10.2210/pdb2ee1/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica
Deposited: 2007-02-15 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Tochio, N. , Watanabe, S. , Yokoyama, S.
Solution structures of the chromo domain of human chromodomain helicase-dna-binding protein 4
Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Tochio, N. , Watanabe, S. , Yokoyama, S.
Primary Citation of Related Structures: 2EE1
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Chromodomain helicase-DNA-binding protein 4 | A | 64 | Salmonella Enterica | GSSGSSGKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNH |
Method: SOLUTION NMR
Deposited Date: 2007-02-15 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Tochio, N. , Watanabe, S. , Yokoyama, S.