Solution structure of the zinc finger, c3hc4 type (ring finger)"" domain of tnf receptor-associated factor 3
PDB DOI: 10.2210/pdb2ecy/pdb
Classification: APOPTOSIS Organism(s): Homo Sapiens
Deposited: 2007-02-14 Deposition Author(s): Abe, H. , Kigawa, T. , Miyamoto, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S. , Yoneyama, M.
Solution structure of the zinc finger, c3hc4 type (ring finger)"" domain of tnf receptor-associated factor 3
Abe, H. , Kigawa, T. , Miyamoto, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S. , Yoneyama, M.
Primary Citation of Related Structures: 2ECY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| TNF receptor-associated factor 3 | A | 66 | Homo Sapiens | GSSGSSGFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVF |
Method: SOLUTION NMR
Deposited Date: 2007-02-14 Deposition Author(s): Abe, H. , Kigawa, T. , Miyamoto, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S. , Yoneyama, M.