Solution structure of the ring domain of the ring finger and chy zinc finger domain-containing protein 1 from mus musculus
PDB DOI: 10.2210/pdb2ecm/pdb
Classification: METAL BINDING PROTEIN Organism(s): Mus Musculus
Deposited: 2007-02-13 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Miyamoto, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Watanabe, S. , Yokoyama, S. , Yoneyama, M.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the ring domain of the ring finger and chy zinc finger domain-containing protein 1 from mus musculus
Harada, T. , Kigawa, T. , Koshiba, S. , Miyamoto, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Watanabe, S. , Yokoyama, S. , Yoneyama, M.
Primary Citation of Related Structures: 2ECM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RING finger and CHY zinc finger domain-containing protein 1 | A | 55 | Mus Musculus | GSSGSSGCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2007-02-13 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Miyamoto, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Watanabe, S. , Yokoyama, S. , Yoneyama, M.