Solution structure of the ring domain of the human tripartite motif-containing protein 39
PDB DOI: 10.2210/pdb2ecj/pdb
Classification: METAL BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2007-02-13 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Miyamoto, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Watanabe, S. , Yokoyama, S.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the ring domain of the human tripartite motif-containing protein 39
Harada, T. , Kigawa, T. , Koshiba, S. , Miyamoto, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Watanabe, S. , Yokoyama, S.
Primary Citation of Related Structures: 2ECJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tripartite motif-containing protein 39 | A | 58 | Homo Sapiens | GSSGSSGALENLQVEASCSVCLEYLKEPVIIECGHNFCKACITRWWEDLERDFPCPVC |
Method: SOLUTION NMR
Deposited Date: 2007-02-13 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Miyamoto, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Watanabe, S. , Yokoyama, S.