Solution structure of human immunodificiency virus type-2 nucleocapsid protein
PDB DOI: 10.2210/pdb2ec7/pdb
Classification: VIRAL PROTEIN Organism(s): Human Immunodeficiency Virus Type 2 (Isolate Ghana-1)
Deposited: 2007-02-10 Deposition Author(s): Endoh, H. , Kodera, Y. , Kohno, T. , Komatsu, H. , Maeda, T. , Matsui, T. , Miyauchi, E. , Tanaka, H. , Tanaka, T.
Solution structure of human immunodificiency virus type-2 nucleocapsid protein
Endoh, H. , Kodera, Y. , Kohno, T. , Komatsu, H. , Maeda, T. , Matsui, T. , Miyauchi, E. , Tanaka, H. , Tanaka, T.
Primary Citation of Related Structures: 2EC7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Gag polyprotein (Pr55Gag) | A | 49 | Human Immunodeficiency Virus Type 2 (Isolate Ghana-1) | AQQRKVIRCWNCGKEGHSARQCRAPRRQGCWKCGKTGHVMAKCPERQAG |
Method: SOLUTION NMR
Deposited Date: 2007-02-10 Deposition Author(s): Endoh, H. , Kodera, Y. , Kohno, T. , Komatsu, H. , Maeda, T. , Matsui, T. , Miyauchi, E. , Tanaka, H. , Tanaka, T.