2EBR
Solution structure of the fourth zf-ranbp domain from human nuclear pore complex protein nup153
PDB DOI: 10.2210/pdb2ebr/pdb
Classification: TRANSPORT PROTEIN Organism(s): Homo Sapiens
Deposited: 2007-02-09 Deposition Author(s): Hayashi, F. , Nagashima, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Zhang, H.P.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the fourth zf-ranbp domain from human nuclear pore complex protein nup153
Hayashi, F. , Nagashima, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Zhang, H.P.
Primary Citation of Related Structures: 2EBR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Nuclear pore complex protein Nup153 | A | 47 | Homo Sapiens | GSSGSSGPEGSWDCELCLVQNKADSTKCLACESAKPGTKSGFKGFDT |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2007-02-09 Deposition Author(s): Hayashi, F. , Nagashima, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Zhang, H.P.