Solution structure of the rwd domain of human rwd domain containing protein 3
PDB DOI: 10.2210/pdb2ebk/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Homo Sapiens
Deposited: 2007-02-09 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Watabe, S. , Yokoyama, S. , Yoneyama, M.
Solution structure of the rwd domain of human rwd domain containing protein 3
Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Watabe, S. , Yokoyama, S. , Yoneyama, M.
Primary Citation of Related Structures: 2EBK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RWD domain-containing protein 3 | A | 128 | Homo Sapiens | GSSGSSGMAEPVQEELSVLAAIFCRPHEWEVLSRSETDGTVFRIHTKAEGFMDADIPLELVFHLPVNYPSCLPGISINSEQLTRAQCVTVKEKLLEQAESLLSEPMVHELVLWIQQNLRHILSQPETG |
Method: SOLUTION NMR
Deposited Date: 2007-02-09 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Watabe, S. , Yokoyama, S. , Yoneyama, M.