Solution structure of the ring domain of the human cell growth regulator with ring finger domain 1 protein
PDB DOI: 10.2210/pdb2ea5/pdb
Classification: CELL CYCLE Organism(s): Homo Sapiens
Deposited: 2007-01-30 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Miyamoto, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tomizawa, T. , Watanabe, S. , Yokoyama, S.
Solution structure of the ring domain of the human cell growth regulator with ring finger domain 1 protein
Harada, T. , Kigawa, T. , Koshiba, S. , Miyamoto, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tomizawa, T. , Watanabe, S. , Yokoyama, S.
Primary Citation of Related Structures: 2EA5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cell growth regulator with RING finger domain protein 1 | A | 68 | Homo Sapiens | GSSGSSGVEPSEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2007-01-30 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Miyamoto, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tomizawa, T. , Watanabe, S. , Yokoyama, S.