C-terminal domain of epsilon subunit of f1f0-atp synthase from the thermophilic bacillus ps3
PDB DOI: 10.2210/pdb2e5u/pdb
Classification: HYDROLASE Organism(s): Bacillus Sp. Ps3
Deposited: 2006-12-25 Deposition Author(s): Akutsu, H. , Yagi, H.
C-terminal domain of epsilon subunit of f1f0-atp synthase from the thermophilic bacillus ps3
Primary Citation of Related Structures: 2E5U
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ATP synthase epsilon chain | A | 40 | Bacillus Sp. Ps3 | IDVLRAKAAKERAERRLQSQQDDIDFKRAELALKRAMNRL |
Method: SOLUTION NMR
Deposited Date: 2006-12-25 Deposition Author(s): Akutsu, H. , Yagi, H.