C-terminal domain of epsilon subunit of f1f0-atp synthase from the thermophilic bacillus ps3 in the presence of atp condition
PDB DOI: 10.2210/pdb2e5t/pdb
Classification: HYDROLASE Organism(s): Bacillus Sp. Ps3
Deposited: 2006-12-22 Deposition Author(s): Akutsu, H. , Yagi, H.
Method: SOLUTION NMR Resolution: N.A.
C-terminal domain of epsilon subunit of f1f0-atp synthase from the thermophilic bacillus ps3 in the presence of atp condition
Primary Citation of Related Structures: 2E5T
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ATP synthase epsilon chain | A | 46 | Bacillus Sp. Ps3 | IDVLRAKAAKERAERRLQSQQDDIDFKRAELALKRAMNRLSVAEMK |
Method: SOLUTION NMR
Deposited Date: 2006-12-22 Deposition Author(s): Akutsu, H. , Yagi, H.