Solution structure of rna binding domain in zinc finger cchc-type and rna binding motif 1
PDB DOI: 10.2210/pdb2e5h/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Homo Sapiens
Deposited: 2006-12-21 Deposition Author(s): Iibuchi, H. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Tsuda, K. , Yokoyama, S.
Solution structure of rna binding domain in zinc finger cchc-type and rna binding motif 1
Iibuchi, H. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Tsuda, K. , Yokoyama, S.
Primary Citation of Related Structures: 2E5H
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc finger CCHC-type and RNA-binding motif-containing protein 1 | A | 94 | Homo Sapiens | GSSGSSGMSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRAINNKQLFGRVIKASIAI |
Method: SOLUTION NMR
Deposited Date: 2006-12-21 Deposition Author(s): Iibuchi, H. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Tsuda, K. , Yokoyama, S.