Solution structure of dsp
PDB DOI: 10.2210/pdb2e2f/pdb
Classification: ANTIFUNGAL PROTEIN Organism(s): Gastrophysa Atrocyanea
Deposited: 2006-11-12 Deposition Author(s): Kawano, K. , Kouno, T. , Mizuguchi, M. , Suzuki, K.
Solution structure of dsp
Kawano, K. , Kouno, T. , Mizuguchi, M. , Suzuki, K.
Primary Citation of Related Structures: 2E2F
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Diapausin | A | 41 | Gastrophysa Atrocyanea | AVRIGPCDQVCPRIVPERHECCRAHGRSGYAYCSGGGMYCN |
Method: SOLUTION NMR
Deposited Date: 2006-11-12 Deposition Author(s): Kawano, K. , Kouno, T. , Mizuguchi, M. , Suzuki, K.