Solution structure of the homeobox domain from human nil-2-a zinc finger protein, transcription factor 8
PDB DOI: 10.2210/pdb2e19/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2006-10-19 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Watanabe, S. , Yokoyama, S.
Solution structure of the homeobox domain from human nil-2-a zinc finger protein, transcription factor 8
Harada, T. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Watanabe, S. , Yokoyama, S.
Primary Citation of Related Structures: 2E19
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription factor 8 | A | 64 | Homo Sapiens | GSSGSSGQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSS |
Method: SOLUTION NMR
Deposited Date: 2006-10-19 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Watanabe, S. , Yokoyama, S.