Solution structure of the ubiquitin-like domain in human fas-associated factor 1 (hfaf1)
PDB DOI: 10.2210/pdb2dzm/pdb
Classification: Structural Genomics Unknown Function Organism(s): Homo Sapiens
Deposited: 2006-09-29 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Watanabe, S. , Yokoyama, S. , Zhao, C.
Solution structure of the ubiquitin-like domain in human fas-associated factor 1 (hfaf1)
Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Watanabe, S. , Yokoyama, S. , Zhao, C.
Primary Citation of Related Structures: 2DZM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| FAS-associated factor 1 | A | 100 | Homo Sapiens | GSSGSSGRMLDFRVEYRDRNVDVVLEDTCTVGEIKQILENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLN |
Method: SOLUTION NMR
Deposited Date: 2006-09-29 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Watanabe, S. , Yokoyama, S. , Zhao, C.