2DYF
Solution structure of the first ww domain of fbp11 / hypa (fbp11 ww1) complexed with a pl (pplp) motif peptide ligand
PDB DOI: 10.2210/pdb2dyf/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens , Saccharomyces Cerevisiae
Deposited: 2006-09-11 Deposition Author(s): Kato, Y. , Kurita, J. , Miyakawa, T. , Tanokura, M.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the first ww domain of fbp11 / hypa (fbp11 ww1) complexed with a pl (pplp) motif peptide ligand
Kato, Y. , Kurita, J. , Miyakawa, T. , Tanokura, M.
Primary Citation of Related Structures: 2DYF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Huntingtin-interacting protein HYPA/FBP11 | A | 30 | Homo Sapiens , Saccharomyces Cerevisiae | GSWTEHKSPDGRTYYYNTETKQSTWEKPDD |
| PL (PPLP) motif peptide from Myosin tail region-interacting protein MTI1 | B | 9 | Homo Sapiens , Saccharomyces Cerevisiae | GSTAPPLPR |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2006-09-11 Deposition Author(s): Kato, Y. , Kurita, J. , Miyakawa, T. , Tanokura, M.