2DXP
Crystal structure of the complex of the archaeal sulfolobus ptp-fold phosphatase with phosphopeptides a-(p)y-r
PDB DOI: 10.2210/pdb2dxp/pdb
Classification: HYDROLASE Organism(s): Paramecium Tetraurelia Strain D4-2 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2006-08-29 Deposition Author(s): Chu, H.M. , Wang, A.H.J.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.1 Å
Crystal structure of the complex of the archaeal sulfolobus ptp-fold phosphatase with phosphopeptides a-(p)y-r
Primary Citation of Related Structures: 2DXP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Sulfolobus solfataricus protein tyrosine phosphatase | A | 161 | Paramecium Tetraurelia Strain D4-2 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MYWVRRKTIGGSGLPYTENEILEWRKEGVKRVLVLPEDWEIEESWGDKDYYLSILKKNGLQPLHIPIPDGGVPSDSQFLTIMKWLLSEKEGNLVHSVGGIGRTGTILASYLILTEGLEVESAIDEVRLVRPGAVQTYEQEMFLLRVEGMRKSWLKNIYSNS |
| A(PTR)R | B | 3 | Paramecium Tetraurelia Strain D4-2 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AYR |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2006-08-29 Deposition Author(s): Chu, H.M. , Wang, A.H.J.