Structure of the zbd in the orthorhomibic crystal from
PDB DOI: 10.2210/pdb2ds5/pdb
Classification: METAL BINDING PROTEIN, PROTEIN BINDING Organism(s): Escherichia Coli
Deposited: 2006-06-22 Deposition Author(s): Hong, S.B. , Lee, B.G. , Park, E.Y. , Song, H.K.
Method: X-RAY DIFFRACTION Resolution: 1.5 Å
Structure of the zbd in the orthorhomibic crystal from
Hong, S.B. , Lee, B.G. , Park, E.Y. , Song, H.K.
Primary Citation of Related Structures: 2DS5
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
ATP-dependent Clp protease ATP-binding subunit clpX | A | 51 | Escherichia Coli | TDKRKDGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCNDIIREEI |
ATP-dependent Clp protease ATP-binding subunit clpX | B | 51 | Escherichia Coli | TDKRKDGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCNDIIREEI |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-06-22 Deposition Author(s): Hong, S.B. , Lee, B.G. , Park, E.Y. , Song, H.K.