PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

2DRN

Docking and dimerization domain (d/d) of the type ii-alpha regulatory subunity of protein kinase a (pka) in complex with a peptide from an a-kinase anchoring protein

PDB DOI: 10.2210/pdb2drn/pdb

Classification: TRANSFERASE
Organism(s): Rattus Norvegicus , Synthetic Construct

Deposited: 2006-06-11
Deposition Author(s): Coghlan, V. , Hausken, Z.E. , Jennings, P.A. , Morikis, D. , Newlon, M.G. , Roy, M. , Scott, J.D.

Experimental Data Snapshot

Method: SOLUTION NMR
Resolution: N.A.

2drn
Literature

Docking and dimerization domain (d/d) of the type ii-alpha regulatory subunity of protein kinase a (pka) in complex with a peptide from an a-kinase anchoring protein

Coghlan, V. , Hausken, Z.E. , Jennings, P.A. , Morikis, D. , Newlon, M.G. , Roy, M. , Scott, J.D.

Primary Citation of Related Structures: 2DRN


Proteins
Molecule Chains Sequence Length Organism Sequence
cAMP-dependent protein kinase type II-alpha regulatory subunit A 46 Rattus Norvegicus , Synthetic Construct HMGHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR
cAMP-dependent protein kinase type II-alpha regulatory subunit B 46 Rattus Norvegicus , Synthetic Construct HMGHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR
24-residues peptide from an a-kinase anchoring protein C 24 Rattus Norvegicus , Synthetic Construct DLIEEAASRIVDAVIEQVKAAGAY
Experimental Data

Method: SOLUTION NMR

Deposited Date: 2006-06-11
Deposition Author(s): Coghlan, V. , Hausken, Z.E. , Jennings, P.A. , Morikis, D. , Newlon, M.G. , Roy, M. , Scott, J.D.