2DRN
Docking and dimerization domain (d/d) of the type ii-alpha regulatory subunity of protein kinase a (pka) in complex with a peptide from an a-kinase anchoring protein
PDB DOI: 10.2210/pdb2drn/pdb
Classification: TRANSFERASE Organism(s): Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2006-06-11 Deposition Author(s): Coghlan, V. , Hausken, Z.E. , Jennings, P.A. , Morikis, D. , Newlon, M.G. , Roy, M. , Scott, J.D.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Docking and dimerization domain (d/d) of the type ii-alpha regulatory subunity of protein kinase a (pka) in complex with a peptide from an a-kinase anchoring protein
Coghlan, V. , Hausken, Z.E. , Jennings, P.A. , Morikis, D. , Newlon, M.G. , Roy, M. , Scott, J.D.
Primary Citation of Related Structures: 2DRN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| cAMP-dependent protein kinase type II-alpha regulatory subunit | A | 46 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | HMGHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR |
| cAMP-dependent protein kinase type II-alpha regulatory subunit | B | 46 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | HMGHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR |
| 24-residues peptide from an a-kinase anchoring protein | C | 24 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DLIEEAASRIVDAVIEQVKAAGAY |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2006-06-11 Deposition Author(s): Coghlan, V. , Hausken, Z.E. , Jennings, P.A. , Morikis, D. , Newlon, M.G. , Roy, M. , Scott, J.D.