Acanthamoeba myosin i sh3 domain bound to acan125
PDB DOI: 10.2210/pdb2drm/pdb
Classification: CONTRACTILE PROTEIN Organism(s): Acanthamoeba , Synthetic Construct
Deposited: 2006-06-09 Deposition Author(s): Bahloul, A. , Houdusse, A. , Ostap, E.M.
Method: X-RAY DIFFRACTION Resolution: 1.35 Å
Acanthamoeba myosin i sh3 domain bound to acan125
Bahloul, A. , Houdusse, A. , Ostap, E.M.
Primary Citation of Related Structures: 2DRM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Acanthamoeba Myosin IB | A | 58 | Acanthamoeba , Synthetic Construct | GPGIQVKALYDYDAQTGDELTFKEGDTIIVHQKDPAGWWEGELNGKRGWVPANYVQDI |
| Acanthamoeba Myosin IB | B | 58 | Acanthamoeba , Synthetic Construct | GPGIQVKALYDYDAQTGDELTFKEGDTIIVHQKDPAGWWEGELNGKRGWVPANYVQDI |
| Acanthamoeba Myosin IB | C | 58 | Acanthamoeba , Synthetic Construct | GPGIQVKALYDYDAQTGDELTFKEGDTIIVHQKDPAGWWEGELNGKRGWVPANYVQDI |
| Acanthamoeba Myosin IB | D | 58 | Acanthamoeba , Synthetic Construct | GPGIQVKALYDYDAQTGDELTFKEGDTIIVHQKDPAGWWEGELNGKRGWVPANYVQDI |
| 18-mer peptide from Acan125 | E | 18 | Acanthamoeba , Synthetic Construct | AKPVPPPRGAKPAPPPRT |
| 18-mer peptide from Acan125 | G | 18 | Acanthamoeba , Synthetic Construct | AKPVPPPRGAKPAPPPRT |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-06-09 Deposition Author(s): Bahloul, A. , Houdusse, A. , Ostap, E.M.