2DRK
Acanthamoeba myosin i sh3 domain bound to acan125
PDB DOI: 10.2210/pdb2drk/pdb
Classification: CONTRACTILE PROTEIN Organism(s): Acanthamoeba Castellanii , Synthetic Construct
Deposited: 2006-06-09 Deposition Author(s): Bahloul, A. , Houdusse, A. , Ostap, E.M.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.42 Å
Acanthamoeba myosin i sh3 domain bound to acan125
Bahloul, A. , Houdusse, A. , Ostap, E.M.
Primary Citation of Related Structures: 2DRK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Myosin heavy chain IB | A | 59 | Acanthamoeba Castellanii , Synthetic Construct | GSPGIQVKALYDYDAQTGDELTFKEGDTIIVHQKDPAGWWEGELNGKRGWVPANYVQDI |
| 10-mer peptide from Myosin-I binding protein Acan125 | B | 10 | Acanthamoeba Castellanii , Synthetic Construct | RPKPVPPPRG |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2006-06-09 Deposition Author(s): Bahloul, A. , Houdusse, A. , Ostap, E.M.