Solution structure of rsgi ruh-065, a uba domain from human cdna
PDB DOI: 10.2210/pdb2do6/pdb
Classification: LIGASE Organism(s): Salmonella Enterica
Deposited: 2006-04-27 Deposition Author(s): Guntert, P. , Hamada, T. , Hirota, H. , Kigawa, T. , Koshiba, S. , Lin, Y.-J. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Yokoyama, S.
Solution structure of rsgi ruh-065, a uba domain from human cdna
Guntert, P. , Hamada, T. , Hirota, H. , Kigawa, T. , Koshiba, S. , Lin, Y.-J. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Yokoyama, S.
Primary Citation of Related Structures: 2DO6
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
E3 ubiquitin-protein ligase CBL-B | A | 53 | Salmonella Enterica | GSSGSSGNVDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFSGPSSG |
E3 ubiquitin-protein ligase CBL-B | B | 53 | Salmonella Enterica | GSSGSSGNVDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2006-04-27 Deposition Author(s): Guntert, P. , Hamada, T. , Hirota, H. , Kigawa, T. , Koshiba, S. , Lin, Y.-J. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Yokoyama, S.