Solution structure of rna binding domain in srp46 splicing factor
PDB DOI: 10.2210/pdb2dnm/pdb
Classification: RNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2006-04-26 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Tsuda, K. , Yokoyama, S.
Solution structure of rna binding domain in srp46 splicing factor
Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Tsuda, K. , Yokoyama, S.
Primary Citation of Related Structures: 2DNM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SRp46 splicing factor | A | 103 | Homo Sapiens | GSSGSSGPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFVRFHDRRDAQDAEAAMDGAELDGRELRVQVARYGRRDLSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2006-04-26 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Tsuda, K. , Yokoyama, S.