2DN5
Solution structure of rsgi ruh-057, a gtf2i domain in human cdna
PDB DOI: 10.2210/pdb2dn5/pdb
Classification: TRANSCRIPTION Organism(s): Salmonella Enterica
Deposited: 2006-04-25 Deposition Author(s): Doi-Katayama, Y. , Hayashi, F. , Hirota, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of rsgi ruh-057, a gtf2i domain in human cdna
Doi-Katayama, Y. , Hayashi, F. , Hirota, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Primary Citation of Related Structures: 2DN5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| General transcription factor II-I repeat domain-containing protein 1 | A | 89 | Salmonella Enterica | GSSGSSGLREQVKELFNEKYGEALGLNRPVLVPYKLIRDSPDAVEVTGLPDDIPFRNPNTYDIHRLEKILKAREHVRMVIINQSGPSSG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2006-04-25 Deposition Author(s): Doi-Katayama, Y. , Hayashi, F. , Hirota, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.