Solution structure of dsrm domain in spermatid perinuclear rna-bind protein
PDB DOI: 10.2210/pdb2dmy/pdb
Classification: RNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2006-04-24 Deposition Author(s): He, F. , Inoue, M. , Kadirvel, S. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Solution structure of dsrm domain in spermatid perinuclear rna-bind protein
He, F. , Inoue, M. , Kadirvel, S. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 2DMY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Spermatid perinuclear RNA-binding protein | A | 97 | Homo Sapiens | GSSGSSGRKILDSKAIDLMNALMRLNQIRPGLQYKLLSQSGPVHAPVFTMSVDVDGTTYEASGPSKKTAKLHVAVKVLQAMGYPTGFDADISGPSSG |
Method: SOLUTION NMR
Deposited Date: 2006-04-24 Deposition Author(s): He, F. , Inoue, M. , Kadirvel, S. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.