Solution structure of the second ww domain of itchy homolog e3 ubiquitin protein ligase (itch)
PDB DOI: 10.2210/pdb2dmv/pdb
Classification: LIGASE Organism(s): Homo Sapiens
Deposited: 2006-04-24 Deposition Author(s): Guntert, P. , Inoue, M. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Paakkonen, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Tomizawa, T. , Yokoyama, S.
Solution structure of the second ww domain of itchy homolog e3 ubiquitin protein ligase (itch)
Guntert, P. , Inoue, M. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Paakkonen, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Tomizawa, T. , Yokoyama, S.
Primary Citation of Related Structures: 2DMV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Itchy homolog E3 ubiquitin protein ligase | A | 43 | Homo Sapiens | GSSGSSGLPPGWEQRVDQHGRVYYVDHVEKRTTWDRPSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2006-04-24 Deposition Author(s): Guntert, P. , Inoue, M. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Paakkonen, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Tomizawa, T. , Yokoyama, S.