Solution structure of the sam_pnt-domain of ets transcription factor pdef (prostate ets)
PDB DOI: 10.2210/pdb2dkx/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2006-04-14 Deposition Author(s): Goroncy, A.K. , Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Yokoyama, S.
Solution structure of the sam_pnt-domain of ets transcription factor pdef (prostate ets)
Goroncy, A.K. , Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Yokoyama, S.
Primary Citation of Related Structures: 2DKX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SAM pointed domain-containing Ets transcription factor | A | 96 | Homo Sapiens | GSSGSSGLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAASGPSSG |
Method: SOLUTION NMR
Deposited Date: 2006-04-14 Deposition Author(s): Goroncy, A.K. , Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Yokoyama, S.