Solution structure of the bromodomain of human protein kiaa1240
PDB DOI: 10.2210/pdb2dkw/pdb
Classification: GENE REGULATION Organism(s): Homo Sapiens
Deposited: 2006-04-14 Deposition Author(s): Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sano, R. , Yokoyama, S. , Yoshida, M.
Solution structure of the bromodomain of human protein kiaa1240
Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sano, R. , Yokoyama, S. , Yoshida, M.
Primary Citation of Related Structures: 2DKW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| hypothetical protein KIAA1240 | A | 131 | Homo Sapiens | GSSGSSGNTLRELRLFLRDVTKRLATDKRFNIFSKPVSDYLEVIKEPMDLSTVITKIDKHNYLTAKDFLKDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDPEFNKLCEEIKESGPSSG |
Method: SOLUTION NMR
Deposited Date: 2006-04-14 Deposition Author(s): Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sano, R. , Yokoyama, S. , Yoshida, M.