Solution structure of smurf2 ww3 domain-smad7 py peptide complex
PDB DOI: 10.2210/pdb2djy/pdb
Classification: LIGASE/SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2006-04-06 Deposition Author(s): Chong, P.A. , Forman-Kay, J.D. , Lin, H , Wrana, J.L.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of smurf2 ww3 domain-smad7 py peptide complex
Chong, P.A. , Forman-Kay, J.D. , Lin, H , Wrana, J.L.
Primary Citation of Related Structures: 2DJY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Smad ubiquitination regulatory factor 2 | A | 42 | Homo Sapiens | GPLGSGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSAN |
| Mothers against decapentaplegic homolog 7 | B | 20 | Homo Sapiens | GPLGSELESPPPPYSRYPMD |
Method: SOLUTION NMR
Deposited Date: 2006-04-06 Deposition Author(s): Chong, P.A. , Forman-Kay, J.D. , Lin, H , Wrana, J.L.