2DIX
Solution structure of the dsrm domain of protein activator of the interferon-induced protein kinase
PDB DOI: 10.2210/pdb2dix/pdb
Classification: RNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2006-03-30 Deposition Author(s): Dang, W. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the dsrm domain of protein activator of the interferon-induced protein kinase
Dang, W. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 2DIX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Interferon-inducible double stranded RNA-dependent protein kinase activator A | A | 84 | Homo Sapiens | GSSGSSGKTPIQVLHEYGMKTKNIPVYECERSDVQIHVPTFTFRVTVGDITCTGEGTSKKLAKHRAAEAAINILKANASGPSSG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2006-03-30 Deposition Author(s): Dang, W. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.