Solution structure of the myb_dna-binding domain of human cell division cycle 5-like protein
PDB DOI: 10.2210/pdb2din/pdb
Classification: DNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2006-03-30 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S. , Yoneyama, M.
Solution structure of the myb_dna-binding domain of human cell division cycle 5-like protein
Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S. , Yoneyama, M.
Primary Citation of Related Structures: 2DIN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cell division cycle 5-like protein | A | 66 | Homo Sapiens | GSSGSSGKKTEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2006-03-30 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S. , Yoneyama, M.