Solution structure of the sh3 domain of the human proline-serine-threonine phosphatase-interacting protein 1
PDB DOI: 10.2210/pdb2dil/pdb
Classification: CELL ADHESION Organism(s): Salmonella Enterica
Deposited: 2006-03-30 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S. , Yoneyama, M.
Solution structure of the sh3 domain of the human proline-serine-threonine phosphatase-interacting protein 1
Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S. , Yoneyama, M.
Primary Citation of Related Structures: 2DIL
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Proline-serine-threonine phosphatase-interacting protein 1 | A | 69 | Salmonella Enterica | GSSGSSGAQEYRALYDYTAQNPDELDLSAGDILEVILEGEDGWWTVERNGQRGFVPGSYLEKLSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2006-03-30 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S. , Yoneyama, M.