2DIL
Solution structure of the sh3 domain of the human proline-serine-threonine phosphatase-interacting protein 1
PDB DOI: 10.2210/pdb2dil/pdb
Classification: CELL ADHESION Organism(s): Homo Sapiens
Deposited: 2006-03-30 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S. , Yoneyama, M.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the sh3 domain of the human proline-serine-threonine phosphatase-interacting protein 1
Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S. , Yoneyama, M.
Primary Citation of Related Structures: 2DIL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Proline-serine-threonine phosphatase-interacting protein 1 | A | 69 | Homo Sapiens | GSSGSSGAQEYRALYDYTAQNPDELDLSAGDILEVILEGEDGWWTVERNGQRGFVPGSYLEKLSGPSSG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2006-03-30 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S. , Yoneyama, M.