Solution structure of the bsd domain of human tfiih basal transcription factor complex p62 subunit
PDB DOI: 10.2210/pdb2dii/pdb
Classification: TRANSCRIPTION Organism(s): Salmonella Enterica
Deposited: 2006-03-30 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Watabe, S. , Yokoyama, S. , Yoneyama, M.
Solution structure of the bsd domain of human tfiih basal transcription factor complex p62 subunit
Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Watabe, S. , Yokoyama, S. , Yoneyama, M.
Primary Citation of Related Structures: 2DII
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
TFIIH basal transcription factor complex p62 subunit | A | 61 | Salmonella Enterica | GSSGSSGFKRKANKELEEKNRMLQEDPVLFQLYKDLVVSQVISAEEFWANRLNVNSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2006-03-30 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Watabe, S. , Yokoyama, S. , Yoneyama, M.