Solution structure of the cue domain in the human activating signal cointegrator 1 complex subunit 2 (ascc2)
PDB DOI: 10.2210/pdb2di0/pdb
Classification: TRANSCRIPTION Organism(s): Salmonella Enterica
Deposited: 2006-03-27 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Watanabe, S. , Yokoyama, S. , Zhao, C.
Solution structure of the cue domain in the human activating signal cointegrator 1 complex subunit 2 (ascc2)
Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Watanabe, S. , Yokoyama, S. , Zhao, C.
Primary Citation of Related Structures: 2DI0
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Activating signal cointegrator 1 complex subunit 2 | A | 71 | Salmonella Enterica | GSSGSSGMCGVELDSLISQVKDLLPDLGEGFILACLEYYHYDPEQVINNILEERLAPTLSQLDRNLDREMN |
Method: SOLUTION NMR
Deposited Date: 2006-03-27 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Watanabe, S. , Yokoyama, S. , Zhao, C.