2DI0
Solution structure of the cue domain in the human activating signal cointegrator 1 complex subunit 2 (ascc2)
PDB DOI: 10.2210/pdb2di0/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2006-03-27 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Watanabe, S. , Yokoyama, S. , Zhao, C.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the cue domain in the human activating signal cointegrator 1 complex subunit 2 (ascc2)
Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Watanabe, S. , Yokoyama, S. , Zhao, C.
Primary Citation of Related Structures: 2DI0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Activating signal cointegrator 1 complex subunit 2 | A | 71 | Homo Sapiens | GSSGSSGMCGVELDSLISQVKDLLPDLGEGFILACLEYYHYDPEQVINNILEERLAPTLSQLDRNLDREMN |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2006-03-27 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Watanabe, S. , Yokoyama, S. , Zhao, C.