Nmr structure of the second kunitz domain of human wfikkn1
PDB DOI: 10.2210/pdb2ddj/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2006-01-30 Deposition Author(s): Liepinsh, E. , Otting, G.
Nmr structure of the second kunitz domain of human wfikkn1
Primary Citation of Related Structures: 2DDJ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1 | A | 70 | Homo Sapiens | EAEAEFTDACVLPAVQGPCRGWEPRWAYSPLLQQCHPFVYGGCEGNGNNFHSRESCEDACPVVDHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2006-01-30 Deposition Author(s): Liepinsh, E. , Otting, G.