Crystal structure of hypothetical protein ms0332
PDB DOI: 10.2210/pdb2db7/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2005-12-15 Deposition Author(s): Murayama, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Takemoto-Hori, C. , Terada, T. , Wang, H. , Yokoyama, S.
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
Crystal structure of hypothetical protein ms0332
Murayama, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Takemoto-Hori, C. , Terada, T. , Wang, H. , Yokoyama, S.
Primary Citation of Related Structures: 2DB7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Hairy/enhancer-of-split related with YRPW motif 1 | A | 64 | Homo Sapiens | GSSGSSGGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREA |
| Hairy/enhancer-of-split related with YRPW motif 1 | B | 64 | Homo Sapiens | GSSGSSGGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREA |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-12-15 Deposition Author(s): Murayama, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Takemoto-Hori, C. , Terada, T. , Wang, H. , Yokoyama, S.