The solution structure of the mynd domain (leu384-cys430) of human zinc finger mynd domain containing protein 10
PDB DOI: 10.2210/pdb2dan/pdb
Classification: METAL BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2005-12-14 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Miyamoto, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sasagawa, A. , Tochio, N. , Yokoyama, S.
The solution structure of the mynd domain (leu384-cys430) of human zinc finger mynd domain containing protein 10
Inoue, M. , Kigawa, T. , Koshiba, S. , Miyamoto, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sasagawa, A. , Tochio, N. , Yokoyama, S.
Primary Citation of Related Structures: 2DAN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc finger MYND domain containing protein 10 | A | 60 | Homo Sapiens | GSSGSSGLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQVKHWEKHGKTCSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-12-14 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Miyamoto, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sasagawa, A. , Tochio, N. , Yokoyama, S.