Solution structure of the first uba domain in the human ubiquitin associated domain containing 1 (ubadc1)
PDB DOI: 10.2210/pdb2dai/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Homo Sapiens
Deposited: 2005-12-14 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Yokoyama, S. , Zhao, C.
Solution structure of the first uba domain in the human ubiquitin associated domain containing 1 (ubadc1)
Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Yokoyama, S. , Zhao, C.
Primary Citation of Related Structures: 2DAI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ubiquitin associated domain containing 1 | A | 83 | Homo Sapiens | GSSGSSGDAVELFKKANAMLDEDEDERVDEAALRQLTEMGFPENRATKALQLNHMSVPQAMEWLIEHAEDPTIDTPLSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-12-14 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Yokoyama, S. , Zhao, C.