Solution structure of the first uba domain in the human ubiquitin specific protease 5 (isopeptidase 5)
PDB DOI: 10.2210/pdb2dag/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2005-12-14 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tomizawa, T. , Yokoyama, S. , Zhao, C.
Solution structure of the first uba domain in the human ubiquitin specific protease 5 (isopeptidase 5)
Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tomizawa, T. , Yokoyama, S. , Zhao, C.
Primary Citation of Related Structures: 2DAG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ubiquitin carboxyl-terminal hydrolase 5 | A | 74 | Homo Sapiens | GSSGSSGLDESVIIQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPGSSGPGSSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-12-14 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tomizawa, T. , Yokoyama, S. , Zhao, C.