Solution structure of the homeobox domain of zinc finger homeobox protein 1b (smad interacting protein 1)
PDB DOI: 10.2210/pdb2da7/pdb
Classification: DNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2005-12-13 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Yokoyama, S.
Solution structure of the homeobox domain of zinc finger homeobox protein 1b (smad interacting protein 1)
Inoue, M. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Yokoyama, S.
Primary Citation of Related Structures: 2DA7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc finger homeobox protein 1b | A | 71 | Homo Sapiens | GSSGSSGSPINPYKDHMSVLKAYYAMNMEPNSDELLKISIAVGLPQEFVKEWFEQRKVYQYSNSRSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-12-13 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Yokoyama, S.