Solution structure of the second homeobox domain of zinc fingers and homeoboxes protein 3 (triple homeobox 1 protein)
PDB DOI: 10.2210/pdb2da5/pdb
Classification: DNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2005-12-13 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Yokoyama, S.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the second homeobox domain of zinc fingers and homeoboxes protein 3 (triple homeobox 1 protein)
Inoue, M. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Yokoyama, S.
Primary Citation of Related Structures: 2DA5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc fingers and homeoboxes protein 3 | A | 75 | Homo Sapiens | GSSGSSGPTKYKERAPEQLRALESSFAQNPLPLDEELDRLRSETKMTRREIDSWFSERRKKVNAEETKKSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-12-13 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Yokoyama, S.