Solution structure of the second homeobox domain of at-binding transcription factor 1 (atbf1)
PDB DOI: 10.2210/pdb2da2/pdb
Classification: TRANSCRIPTION Organism(s): Salmonella Enterica
Deposited: 2005-12-13 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S.
Solution structure of the second homeobox domain of at-binding transcription factor 1 (atbf1)
Inoue, M. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S.
Primary Citation of Related Structures: 2DA2
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Alpha-fetoprotein enhancer binding protein | A | 70 | Salmonella Enterica | GSSGSSGRSSRTRFTDYQLRVLQDFFDANAYPKDDEFEQLSNLLNLPTRVIVVWFQNARQKARKSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-12-13 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S.