Solution structure of the chromo domain of chromobox homolog 2 from human
PDB DOI: 10.2210/pdb2d9u/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Homo Sapiens
Deposited: 2005-12-13 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Yokoyama, S.
Solution structure of the chromo domain of chromobox homolog 2 from human
Inoue, M. , Kigawa, T. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Yokoyama, S.
Primary Citation of Related Structures: 2D9U
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromobox protein homolog 2 (isoform 2) | A | 74 | Homo Sapiens | GSSGSSGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEHEKEVQNSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-12-13 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Yokoyama, S.