Solution structure of the smr domain of nedd4-binding protein 2
PDB DOI: 10.2210/pdb2d9i/pdb
Classification: APOPTOSIS Organism(s): Homo Sapiens
Deposited: 2005-12-09 Deposition Author(s): Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M. , Zhang, H.P.
Solution structure of the smr domain of nedd4-binding protein 2
Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M. , Zhang, H.P.
Primary Citation of Related Structures: 2D9I
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| NEDD4-binding protein 2 | A | 96 | Homo Sapiens | GSSGSSGQNVLDLHGLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLKSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-12-09 Deposition Author(s): Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M. , Zhang, H.P.