Structure of chorismate mutase (form ii) from thermus thermophilus hb8
PDB DOI: 10.2210/pdb2d8e/pdb
Classification: ISOMERASE Organism(s): Thermus Thermophilus
Deposited: 2005-12-02 Deposition Author(s): Bagautdinov, B. , Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi)
Method: X-RAY DIFFRACTION Resolution: 1.75 Å
Structure of chorismate mutase (form ii) from thermus thermophilus hb8
Bagautdinov, B. , Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi)
Primary Citation of Related Structures: 2D8E
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| phospho-2-dehydro-3-deoxyheptonate aldolase/chorismate mutase | A | 90 | Thermus Thermophilus | MDERIQALRKEVDRVNREILRLLSERGRLVQEIGRLQTELGLPHYDPKREEEMLAYLTAENPGPFPDETIRKLFKEIFKASLDLEERQDQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-12-02 Deposition Author(s): Bagautdinov, B. , Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi)