Structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form ii
PDB DOI: 10.2210/pdb2d5d/pdb
Classification: LIPID BINDING PROTEIN,TRANSFERASE Organism(s): Prochlorococcus Phage P-Scsp1U
Deposited: 2005-11-01 Deposition Author(s): Bagautdinov, B. , Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi)
Structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form ii
Bagautdinov, B. , Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi)
Primary Citation of Related Structures: 2D5D
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
methylmalonyl-CoA decarboxylase gamma chain | A | 74 | Prochlorococcus Phage P-Scsp1U | MVVSENVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEAVDTGQPLIELG |
methylmalonyl-CoA decarboxylase gamma chain | B | 74 | Prochlorococcus Phage P-Scsp1U | MVVSENVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEAVDTGQPLIELG |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-11-01 Deposition Author(s): Bagautdinov, B. , Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi)