Solution structure of the human beta4a-a domain
PDB DOI: 10.2210/pdb2d46/pdb
Classification: METAL TRANSPORT Organism(s): Salmonella Enterica
Deposited: 2005-10-10 Deposition Author(s): Horne, W.A. , Lyons, B.A. , Rithner, C.D. , Vendel, A.C.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the human beta4a-a domain
Horne, W.A. , Lyons, B.A. , Rithner, C.D. , Vendel, A.C.
Primary Citation of Related Structures: 2D46
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
calcium channel, voltage-dependent, beta 4 subunit isoform a | A | 61 | Salmonella Enterica | GSHMYDNLYLHGIEDSEAGSADSYTSRPSDSDVSLEEDREAIRQEREQQAAIQLERAKSKP |
Method: SOLUTION NMR
Deposited Date: 2005-10-10 Deposition Author(s): Horne, W.A. , Lyons, B.A. , Rithner, C.D. , Vendel, A.C.