Solution structure of the homeobox domain of the human paired box protein pax-6
PDB DOI: 10.2210/pdb2cue/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2005-05-26 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Tomizawa, T. , Yokoyama, S.
Solution structure of the homeobox domain of the human paired box protein pax-6
Inoue, M. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Tomizawa, T. , Yokoyama, S.
Primary Citation of Related Structures: 2CUE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Paired box protein Pax6 | A | 80 | Homo Sapiens | GSSGSSGQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-26 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Tomizawa, T. , Yokoyama, S.